If you have been reading about AOD-9604 and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-03-12. Where a claim depends on a specific study, the study is described rather than over-claimed.
In laboratory settings, AOD-9604 is commonly supplied as a lyophilized powder and stored cold to limit degradation. Reconstituted solutions are typically kept refrigerated or frozen, depending on the buffer and concentration, and protected from repeated freeze-thaw cycles. Stability can be influenced by pH, temperature, and the presence of proteases. Purity is usually assessed by high-performance liquid chromatography and mass spectrometry. These practices support reproducibility, but they do not imply safety or efficacy for any human use.
Regulatory status: AOD-9604 is not approved as a therapeutic drug in the United States, European Union, or other major markets. It is listed by the World Anti-Doping Agency as a prohibited substance in sport, specifically under growth hormone fragments. Many jurisdictions restrict its sale for human consumption. Products marketed online may not meet pharmaceutical quality standards. The legal status varies by country and often depends on whether the material is presented as a research chemical, supplement, or drug.
Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.
Research on AOD-9604 also examines how the peptide is measured in biological samples. Analytical methods may include liquid chromatography coupled with mass spectrometry, immunoassays, or both. Detection can be challenging because the peptide is small and may be present at low concentrations. Published methods vary in sensitivity and specificity, so comparative interpretation requires attention to validation details. The presence of related hGH fragments can complicate identification in some matrices.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine | Status varies by country; prohibited in sport. |
| Common storage temperature | 2–8 °C for lyophilized powder | Protect from light and moisture; follow supplier instructions. |
| Typical analytical method | LC-MS/MS | Used for identification and quantification in biological samples. |
| Purity assessment | HPLC and mass spectrometry | Reverse-phase HPLC is common for peptide purity. |
| Common synonyms | AOD9604; hGH 176-191 fragment | Naming conventions differ across studies. |
AOD-9604 is a synthetic peptide that corresponds to a short section of human growth hormone. It is commonly identified as hGH fragment 176-191 because its sequence matches residues at the C-terminal end of the hormone. The molecule contains sixteen amino acids and is made by solid-phase peptide synthesis. Researchers study it for metabolic effects rather than for the growth-promoting actions associated with full human growth hormone. Its small size distinguishes it from the complete 191-amino-acid hormone.
Several names appear in scientific and commercial settings. AOD9604 and AOD-9604 are development codes used interchangeably, while hGH fragment 176-191 describes the same region. The peptide includes a disulfide bond between two cysteine residues, which helps shape its three-dimensional structure. Different suppliers may provide acetate or other salt forms, and purity can vary. These differences matter because analytical tests and biological assays can respond to the specific form being studied.
AOD-9604 drew attention in the 1990s and 2000s as a potential anti-obesity agent. Early work explored both injectable and oral routes, which is unusual for a peptide of this size. Animal studies reported changes in fat metabolism without the growth-promoting or insulin-like effects associated with full-length growth hormone. Subsequent human trials produced mixed or modest results, and the compound did not obtain regulatory approval for weight management in major markets. It remains known mainly through research literature, sports anti-doping listings, and non-approved supplement advertising.
AOD-9604 is prohibited in sport by the World Anti-Doping Agency under the peptide hormone class. Its presence in a sample can be detected through mass spectrometry-based methods, although the exact assay depends on the laboratory. In research settings, material is often supplied as a lyophilized powder for reconstitution. Buyers and researchers should note that products labeled AOD-9604 may vary in purity and actual peptide content. Analytical certificates and independent testing are common ways to verify identity, but no global harmonized standard exists for all commercial lots.
AOD-9604 is a synthetic peptide whose sequence is modeled on the C-terminal region of human growth hormone. Published descriptions commonly place it as a modified fragment corresponding to hGH amino acids 176–191, with a tyrosine residue added or retained at the N-terminus to support detection and handling. It is not intact growth hormone and lacks the full receptor-binding architecture of the parent protein. The molecule was developed as a research candidate for metabolic studies rather than as a replacement for growth hormone therapy. Its identity is defined by its amino acid sequence rather than by any single commercial preparation.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to residues 176-191 of the 191-amino-acid hGH sequence. The fragment is not the full hormone and lacks the receptor-binding region associated with growth and metabolic effects of hGH. Researchers developed it to isolate a specific portion of hGH for study. Its exact sequence and length are often stated in peptide catalogs and patents.
The peptide is frequently described as a growth hormone fragment, although it is chemically distinct from full-length hGH. AOD-9604 contains 16 amino acids and includes two cysteine residues that can form an intramolecular disulfide bond. In solution, this structural feature can influence folding, aggregation, and stability. Published descriptions sometimes call it hGH 176-191 or AOD9604, with spacing and capitalization varying. Such naming differences can complicate literature searches, database entries, and product verification.
Researchers have studied the fragment in cell and animal models to understand its metabolic actions. Some experiments report effects on fat breakdown and fat storage pathways, but the underlying mechanism remains incompletely defined. AOD-9604 does not appear to stimulate the same broad growth hormone receptor signaling as full-length hGH. Whether its observed activities arise from direct receptor interactions or downstream metabolic changes is an open question. Results from different assays are not always consistent.
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
=== Local boards and sanitary districts === Outside of municipal boroughs, there was no effective local government until the 1840s. In response to poor sanitary conditions and outbreaks of cholera, the Public Health Act 1848 (11 & 12 Vict. c. 63) and the Local Government Act 1858 allowed for the formation of local boards of health in populous areas. Local boards were responsible among other things for water supply, drainage, sewerage, paving and cleansing. Eleven local boards were initially formed at Brampton, Cleator Moor, Cockermouth, Egremont, Holme Cultram, Keswick, Maryport, Millom, Penrith, Whitehaven, Wigton and Workington. Further reform under the Public Health Act 1875 (38 & 39 Vict. c. 55) saw the creation of sanitary districts throughout England and Wales. The existing municipal boroughs and local boards became "urban sanitary districts", while "rural sanitary districts" were formed from the remaining areas of the poor law unions. Three more local boards were formed: Arlecdon and Frizington in 1882, Harrington in 1891 and Aspatria in 1892. In addition Workington and Whitehaven received charters of incorporation to become municipal boroughs in 1883 and 1894 respectively.
More recent evidence suggests that estrogen promotes cholestasis via its metabolite estradiol-17-β-D-glucuronide (E2). E2 secreted into the canaliculi by MRP2 was found to repress the transcription of bile salt export pump (BSEP), the apical ABC transporter responsible for exporting monoanionic conjugated bile acids from hepatocytes into bile canaliculi. E2 was also found to upregulate miR-148a, which represses expression of the pregnane X receptor (PXR). PXR is a nuclear receptor in hepatocytes that senses intracellular bile acid concentrations and regulates gene expression accordingly to increase bile efflux. Genetic predisposition for ICP is suggested by familial and regional clustering of cases. Several studies have implicated heterozygous mutations of the genes ABCB11 and ABCB4 in ICP, which respectively encode the canalicular transport proteins BSEP and multidrug resistance protein 3 (MDR3). MDR3 is responsible for exporting phosphatidylcholine, the major lipid component of bile, into bile canaliculi where it forms micelles with bile salts to prevent the latter from damaging luminal epithelium. Bile flow requires canalicular secretion of both bile salts and phosphatidylcholine. MDR3 mutations are an established predisposing factor, found in 16% of ICP cases. More recently, studies have demonstrated involvement of BSEP mutations in at least 5% of cases. The V444A polymorphism of ABCB11 in particular may lead to ICP by causing a reduction in hepatic BSEP expression and consequently decreased bile salt export.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
Cell junctions, protein complexes that provide contact between cells and neighbouring cells or the extracellular matrix, are especially abundant in epithelial tissues. They build up the paracellular barrier of epithelia and control the paracellular transport. There are five main types of cell junctions: tight junctions, adherens junctions, desmosomes, hemidesmosomes, and gap junctions.
Sources: en.wikipedia.org
== Production == Bronopol is produced by the bromination of di(hydroxymethyl)nitromethane, which is derived from nitromethane by a nitroaldol reaction. World production increased from the tens of tonnes in the late 1970s to current estimates in excess of 5,000 tonnes. Production today is the business of low cost producers, mainly in China.
In fact, it is possible to ionize most elements with a single laser set-up, thus enabling rapid switching from one element to another. In the early days, optical schemes from RIMS have been used to study over 70 elements and over 39 elements can be ionized with a single laser combination using a rapid computer-modulated framework that switches elements within seconds.
Another study of the PfSPZ vaccine was published in December 2022, reporting vaccine efficacy at up to 48% at 6 months follow up, and up to 46% efficacy at 18 months. Recent field studies have evaluated PfSPZ Vaccine in malaria-experienced African adults. A randomized, double-blind, placebo-controlled trial in Burkina Faso tested a three-dose intravenous regimen and reported vaccine efficacy of up to 48% at 6 months and 46% at 18 months against naturally acquired Plasmodium falciparum infection. The vaccine was well tolerated and immunogenic in this population. Additional studies in Equatorial Guinea examined multi-dose priming regimens of PfSPZ Vaccine followed by controlled human malaria infection (CHMI). Several schedules were found to be safe and capable of inducing significant protection against homologous challenge. By 2022 more than twenty clinical trials of PfSPZ-based products had been completed or were ongoing across Africa, Europe and the United States. PfSPZ Vaccine has also been evaluated in women of childbearing age and in participants who later became pregnant. Two randomized, double-blind, placebo-controlled trials in Mali investigated vaccination following presumptive antimalarial treatment. Across two transmission seasons, vaccine efficacy against Plasmodium falciparum parasitaemia in women of childbearing age ranged from 41% to 61%, depending on dose and year of follow-up. Among participants who conceived after vaccination, the vaccine was safe for mothers and infants and reduced the incidence of malaria parasitaemia during pregnancy.
Sources: en.wikipedia.org
restriction mapping The use of type II restriction endonucleases to cleave DNA molecules at specific restriction sites in order to produce characteristic patterns of fragments which can be resolved by size using gel electrophoresis. Digesting DNA molecules such as genomic DNA or plasmids with one or multiple restriction enzymes makes it possible to deduce from the sizes of the resulting fragments the order or arrangement of the restriction sites within the molecule and the distances between them, and thus to construct reliable maps with restriction sites effectively serving as genetic markers.
=== Manuscript locations === Before his death, Tolkien negotiated the sale of the manuscripts, drafts, proofs and other materials related to his then-published works—including The Lord of the Rings, The Hobbit and Farmer Giles of Ham—to the Department of Special Collections and University Archives at Marquette University's John P. Raynor, S.J., Library in Milwaukee, Wisconsin, United States. After his death his estate donated the papers containing Tolkien's Silmarillion mythology and his academic work to the Bodleian Library at Oxford University. The Bodleian Library held an exhibition of his work in 2018, including more than 60 items which had never been seen in public before. In 2009 a partial draft of Language and Human Nature, which Tolkien had begun co-writing with Lewis but had never completed, was discovered at the Bodleian Library.
Selective serotonin reuptake inhibitors and mirtazapine have been recommended for depression, while atypical antipsychotics are recommended for psychosis and behavioral problems. Specialist neuropsychiatric input is recommended since people may require long-term treatment with multiple medications in combination.
This makes muscle tissue approximately 15% denser than fat tissue. Skeletal muscle is a highly oxygen-consuming tissue, and oxidative DNA damage that is induced by reactive oxygen species tends to accumulate with age. The oxidative DNA damage 8-OHdG accumulates in heart and skeletal muscle of both mouse and rat with age. Also, DNA double-strand breaks accumulate with age in the skeletal muscle of mice.
Sources: en.wikipedia.org
No major regulatory agency has approved AOD-9604 as a medicine. It is treated as an experimental peptide in research settings. Some countries restrict its sale or import.
The World Anti-Doping Agency classifies growth hormone fragments, including AOD-9604, as prohibited substances. The classification reflects concern about potential performance-enhancing use. Athletes are subject to testing for such peptides.
Detection typically uses liquid chromatography combined with mass spectrometry. These methods separate the peptide and identify it by mass. Immunoassays may screen samples but require confirmation by a more specific technique.
No. It is not approved as a therapeutic drug by major regulators. It is sold for research purposes in many settings, which is not the same as clinical approval.