lyophilized powder raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-04-29 and is reviewed periodically as new material appears.
Quality varies among research-grade suppliers, so certificates of analysis and independent testing are important for verification. A typical certificate reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes residual solvents or water content. AOD9604 is often sold as a research chemical not intended for human consumption, and labels can be inaccurate. Common misconceptions include treating the peptide as a form of growth hormone, assuming supplement status, or expecting approved-drug quality from unregulated products.
AOD9604 is commonly supplied as a white to off-white lyophilized powder. The powder is typically stored at -20 °C or below, protected from light and moisture, because peptides can degrade through oxidation, hydrolysis, or aggregation. If it is reconstituted for laboratory use, an appropriate aqueous buffer or solvent is chosen, and the solution is kept cold and handled to avoid repeated freeze-thaw cycles. These practices support stability but do not imply suitability for human use.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography and mass spectrometry. Reversed-phase HPLC separates the peptide from related impurities and can estimate purity by ultraviolet absorbance, while mass spectrometry confirms the molecular mass and detects modifications. Peptide mapping, amino acid analysis, and disulfide mapping may be used when the sequence or disulfide arrangement must be verified. Because AOD9604 contains cysteine residues, oxidation and disulfide isomers are possible quality concerns in synthetic batches.
In laboratory settings, AOD-9604 is commonly supplied as a lyophilized powder and stored cold to limit degradation. Reconstituted solutions are typically kept refrigerated or frozen, depending on the buffer and concentration, and protected from repeated freeze-thaw cycles. Stability can be influenced by pH, temperature, and the presence of proteases. Purity is usually assessed by high-performance liquid chromatography and mass spectrometry. These practices support reproducibility, but they do not imply safety or efficacy for any human use.
Regulatory status: AOD-9604 is not approved as a therapeutic drug in the United States, European Union, or other major markets. It is listed by the World Anti-Doping Agency as a prohibited substance in sport, specifically under growth hormone fragments. Many jurisdictions restrict its sale for human consumption. Products marketed online may not meet pharmaceutical quality standards. The legal status varies by country and often depends on whether the material is presented as a research chemical, supplement, or drug.
Detection and characterization of AOD-9604 in research and anti-doping settings typically rely on mass spectrometry coupled with liquid chromatography. These methods can identify the peptide by its mass and fragmentation pattern. Immunoassays may also be used in some screening contexts, but they can cross-react with related peptides. Because the molecule is small and may be present at low concentrations, sample preparation and method validation are important. Confirmatory analysis usually requires comparison with a certified reference standard.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized form; visual inspection |
| Solubility | Soluble in water and aqueous buffers | Depends on pH, purity, and counterion |
| Typical storage | -20 °C or below, desiccated | Protect from light; avoid repeated freeze-thaw after reconstitution |
| Common analytical method | Reversed-phase HPLC and mass spectrometry | Purity by HPLC; identity and mass by LC-MS or MALDI-TOF |
| Common synonyms | hGH fragment 176–191; AOD-9604 | Names vary in research and product labeling |
Detection of AOD-9604 in biological samples relies on analytical techniques capable of distinguishing a small synthetic peptide from related endogenous sequences. Liquid chromatography coupled with tandem mass spectrometry is commonly used for confirmatory analysis. Sample preparation may involve immunoaffinity enrichment or solid-phase extraction to concentrate the peptide. Because the molecule is small and may be present at low concentrations, assay sensitivity and specificity are ongoing analytical challenges. Laboratories also validate methods against reference materials when available.
Regulatory interest in AOD-9604 increased after high-profile anti-doping cases involving peptide products. In some cases, the substance was supplied under alternative names or in compounded preparations, complicating traceability. Sports tribunals and anti-doping panels have discussed whether the peptide was explicitly banned at the time of use, leading to clarifications by the World Anti-Doping Agency. For consumers and researchers, the legal status can vary by jurisdiction, and products marketed as research chemicals may lack independent quality verification.
AOD-9604 is listed as a prohibited substance in sport by the World Anti-Doping Agency. It falls under the peptide hormones, growth factors, related substances, and mimetics class on the prohibited list. Anti-doping organizations treat its presence in an athlete's sample as an adverse finding unless a therapeutic use exemption applies. The prohibition reflects concerns about performance enhancement in competitive settings and the difficulty of distinguishing exogenous peptide use from endogenous hormone fragments.
AOD-9604 is prohibited in sport by the World Anti-Doping Agency under the peptide hormone class. Its presence in a sample can be detected through mass spectrometry-based methods, although the exact assay depends on the laboratory. In research settings, material is often supplied as a lyophilized powder for reconstitution. Buyers and researchers should note that products labeled AOD-9604 may vary in purity and actual peptide content. Analytical certificates and independent testing are common ways to verify identity, but no global harmonized standard exists for all commercial lots.
AOD-9604 is a synthetic peptide whose sequence is modeled on the C-terminal region of human growth hormone. Published descriptions commonly place it as a modified fragment corresponding to hGH amino acids 176–191, with a tyrosine residue added or retained at the N-terminus to support detection and handling. It is not intact growth hormone and lacks the full receptor-binding architecture of the parent protein. The molecule was developed as a research candidate for metabolic studies rather than as a replacement for growth hormone therapy. Its identity is defined by its amino acid sequence rather than by any single commercial preparation.
Research interest in AOD-9604 often focuses on whether it can influence lipid metabolism without the growth-promoting or glucose-related effects of full-length hGH. This question remains unresolved, and findings depend on model, dose, and measurement method. Some reviews treat the peptide as a historical obesity candidate rather than an active therapeutic. Others cite it in discussions of peptide fragments, metabolic signaling, and performance-enhancing substances. Clear conclusions are limited by the small number of rigorous, independent human studies.
AOD-9604 has been investigated primarily as a potential treatment for obesity and related metabolic conditions. Early laboratory work examined its effects on fat cells, and later studies moved into animal models and human clinical trials. Some trials reportedly reached Phase II, but the program did not lead to an approved medicine. Published summaries often note that weight-loss results were modest or inconsistent. The full trial data are not all publicly available in detail.
Clinical development of AOD9604 included trials in people with obesity, but the results did not lead to approval as a prescription medicine in major markets. Interest later shifted to research settings and to unapproved products marketed for body composition. Regulatory agencies have questioned whether the peptide qualifies as a dietary ingredient, and some have issued warnings about its presence in supplements. Long-term human safety data are limited, and questions about efficacy, dosing, and target populations remain unresolved.
AOD9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to a short sequence near the end of the 191-amino-acid hormone, often described as residues 176–191 or a related fragment. Researchers designed it to separate metabolic effects from the growth-promoting actions of full-length growth hormone. Early work in the 1990s explored it as a candidate for weight and lipid disorders. It is not a naturally circulating hormone fragment produced in large amounts.
Laboratory studies have reported that AOD9604 can increase lipolysis and reduce lipid accumulation in fat cells. The precise molecular target remains uncertain, and the compound does not appear to activate the growth hormone receptor in the same way as full-length hGH. Proposed mechanisms include effects on beta-adrenergic signaling and enzymes involved in fatty acid synthesis, but these pathways are not firmly established. Because most evidence comes from cell and animal models, whether the same effects occur in humans is an open question.
== Further reading == Bachner, Paul (2021). In further pursuit of excellence: the college of American pathologists 1946-2020 (PDF) (1st ed.). Northfield: College of American Pathologists. ISBN 978-1-941096-61-1.
=== Kinases === Posttranslational modification of proteins with phosphate groups by kinases is a key regulatory step throughout all biological systems. Phosphorylation events, either phosphorylation by protein kinases or dephosphorylation by phosphatases, result in protein activation or deactivation. These events have an impact on the regulation of physiological pathways, which makes the ability to dissect and study these pathways integral to understanding the details of cellular processes. There exist a number of challenges—namely the sheer size of the phosphoproteome, the fleeting nature of phosphorylation events and related physical limitations of classical biological and biochemical techniques—that have limited the advancement of knowledge in this area. Through the use of small molecule modulators of protein kinases, chemical biologists have gained a better understanding of the effects of protein phosphorylation. For example, nonselective and selective kinase inhibitors, such as a class of pyridinylimidazole compounds are potent inhibitors useful in the dissection of MAP kinase signaling pathways. These pyridinylimidazole compounds function by targeting the ATP binding pocket. Although this approach, as well as related approaches, with slight modifications, has proven effective in a number of cases, these compounds lack adequate specificity for more general applications. Another class of compounds, mechanism-based inhibitors, combines knowledge of the kinase enzymology with previously utilized inhibition motifs.
According to scientists assessing the Dino Gangs program, the evidence for pack hunting in Tarbosaurus and Albertosaurus is weak and based on group skeletal remains for which alternate explanations may apply (such as drought or a flood forcing dinosaurs to die together in one place). Others researchers have speculated that instead of large theropod social groups, some of these finds represent behavior more akin to Komodo dragon-like mobbing of carcasses, even going as far as to say true pack-hunting behavior may not exist in any non-avian dinosaurs due to its rarity in modern predators. Pathologies of Tyrannosaurus specimens have been suggested as evidence of conspecific attack, including "Wyrex" with a hole penetrating its jugual and severe trauma on its tail that shows signs of bone remodeling (not regrowth).
== Society and culture == Much medical research has been done into the causes of osteogenesis imperfecta, benefiting not only those with OI but medicine more broadly; in the ten years between 2006 and 2016, the many discoveries of non-collagen related recessive gene mutations, which still led in those who have them to the clinical signs of OI, led to numerous breakthroughs in medical understanding of the process of healthy bone development.
In the United States, when plutonium-238 became available for non-military uses, numerous applications were proposed and tested, including the cardiac pacemaker program that began on June 1, 1966, in conjunction with NUMEC. The last of these units was implanted in 1988, as lithium-powered pacemakers, which had an expected lifespan of 10 or more years without the disadvantages of radiation concerns and regulatory hurdles, made these units obsolete. As of 2007, there were nine living people with nuclear-powered pacemakers in the United States, out of an original 139 recipients. When these individuals die, the pacemaker is supposed to be removed and shipped to Los Alamos where the plutonium will be recovered. In a letter to the New England Journal of Medicine discussing a woman who received a Numec NU-5 decades ago that is continuously operating, despite an original $5,000 price tag equivalent to $36,263 in 2025 dollars, the follow-up costs have been about $19,000 ($29,502 in 2025 dollars) compared with $55,000 ($85,400 in 2025 dollars) for a battery-powered pacemaker. Another nuclear powered pacemaker was the Medtronics “Laurens-Alcatel Model 9000”. Approximately 1600 nuclear-powered cardiac pacemakers and/or battery assemblies have been located across the United States, and are eligible for recovery by the Off-Site Source Recovery Project (OSRP) Team at Los Alamos National Laboratory (LANL).
Sources: en.wikipedia.org
== Names == The initial strikes on Iran were codenamed Operation Epic Fury by the United States government, and Operation Roaring Lion by the Israeli government, in line with their codename of Operation Rising Lion for their strikes on Iran during the Twelve-Day War in June 2025. Iran codenamed its response Operation True Promise IV (Persian: عملیات وعده صادق ۴, romanized: Amaliyat-e Va'deh-ye Sadegh 4). American media outlets have generally referred to the conflict as the Iran war. The war has also been referred to by some outlets as the "Third Gulf War" (Gulf War III), following the Gulf War (1990–1991), and the Iraq War/Second Gulf War (Gulf War II) (2003–2011). Iranian state media has referred to the conflict as the "Third Imposed War", with the Iran–Iraq War (1980–1988) and the Twelve-Day War respectively as the "First" and "Second". Due to the war starting during the month of Ramadan, it has sometimes been called the "Ramadan War". The American codename morphed into "Operation Epstein Fury", which became popularized across many social media platforms and also drew criticism from the ADL.
In 2024, Albirex Niigata Singapore underwent localisation with players now predominantly Singaporean. This as well as the exit of DPMM FC means that from the 2025–26 season, all participants of the Singapore Premier League are local clubs. In recent years, foreign clubs from other countries have also been invited to participate in the Singapore Cup. The most recent entrant was BG Pathum United of the Thai League 1 at the 2024–25 Singapore Cup.
If oxygen saturation in sea water drops to about 1–10% it can be fatal for Octopus vulgaris depending on the weight of the animal and the water temperature. Ventilation may increase to pump more water carrying oxygen across the gills but due to receptors found on the gills the energy use and oxygen uptake remains at a stable rate. The high percent of oxygen extraction allows for energy saving and benefits for living in an area of low oxygen concentration. Water is pumped into the mantle cavity of the octopus, where it comes into contact with the internal gills. The water has a high concentration of oxygen compared to the blood returning from the veins, so oxygen diffuses into the blood. The tissues and muscles of the octopus use oxygen and release carbon dioxide when breaking down glucose in the Krebs cycle. The carbon dioxide then dissolves into the blood or combines with water to form carbonic acid, which decreases blood pH. The Bohr effect explains why oxygen concentrations are lower in venous blood than arterial blood and why oxygen diffuses into the bloodstream. The rate of diffusion is affected by the distance the oxygen has to travel from the water to the bloodstream as indicated by Fick's laws of diffusion. Fick's laws explain why the gills of the octopus contain many small folds that are highly vascularized. They increase surface area, thus also increase the rate of diffusion. The capillaries that line the folds of the gill epithelium have a very thin tissue barrier (10 μm), which allows for fast, easy diffusion of the oxygen into the blood.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Sources: en.wikipedia.org
Lyophilized AOD9604 is generally kept at -20 °C or colder, desiccated, and protected from light. Reconstituted solutions are usually refrigerated and handled to minimize repeated freeze-thaw cycles. These are general laboratory handling practices, not instructions for human use.
Mass spectrometry, such as LC-MS or MALDI-TOF, confirms the molecular mass and can reveal sequence-related impurities. Reversed-phase HPLC is used for purity, and peptide mapping or amino acid analysis can support sequence identity. No single method establishes every quality attribute.
No. AOD9604 is a short synthetic fragment of the hGH sequence, not the full 191-amino-acid hormone. It lacks the regions that mediate hGH receptor activation and growth-promoting effects. Products labeled as AOD9604 should not be assumed to have the same properties as hGH.
No major regulatory agency has approved AOD-9604 as a medicine. It is treated as an experimental peptide in research settings. Some countries restrict its sale or import.